![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (37 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries) |
![]() | Domain d2w0ja_: 2w0j A: [231369] automated match to d2x7fa_ complexed with no3, zat |
PDB Entry: 2w0j (more details), 2.05 Å
SCOPe Domain Sequences for d2w0ja_:
Sequence, based on SEQRES records: (download)
>d2w0ja_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} svypkalrdeyimsktlgsgacgevklaferktckkvaikiiskrkfaigsareadpaln veteieilkklnhpciikiknffdaedyyivlelmeggelfdkvvgnkrlkeatcklyfy qmllavqylhengiihrdlkpenvllssqeedclikitdfghskilgetslmrtlcgtpt ylapevlvsvgtagynravdcwslgvilficlsgyppfsehrtqvslkdqitsgkynfip evwaevsekaldlvkkllvvdpkarftteealrhpwlqdedmkrkfqdllseenestalp q
>d2w0ja_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} svypkalrdeyimsktlgsgevklaferktckkvaikiisknveteieilkklnhpciik iknffdaedyyivlelmeggelfdkvvgnkrlkeatcklyfyqmllavqylhengiihrd lkpenvllssqeedclikitdfghskiltslmrtlcgtptylapevlvsvgtagynravd cwslgvilficlsgyppfsehrtqvslkdqitsgkynfipevwaevsekaldlvkkllvv dpkarftteealrhpwlqdedmkrkfqdllseenetalpq
Timeline for d2w0ja_: