Lineage for d2vu1a2 (2vu1 A:269-392)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916742Protein Biosynthetic thiolase, C-terminal domain [419021] (1 species)
  7. 2916743Species Zoogloea ramigera [TaxId:350] [419503] (16 PDB entries)
    Uniprot P07097
  8. 2916748Domain d2vu1a2: 2vu1 A:269-392 [206463]
    Other proteins in same PDB: d2vu1a1, d2vu1b1, d2vu1c1, d2vu1d1
    automated match to d1m4sa2
    complexed with na, opi, so4

Details for d2vu1a2

PDB Entry: 2vu1 (more details), 1.51 Å

PDB Description: biosynthetic thiolase from z. ramigera. complex of with o-pantheteine- 11-pivalate.
PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d2vu1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vu1a2 c.95.1.1 (A:269-392) Biosynthetic thiolase, C-terminal domain {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

SCOPe Domain Coordinates for d2vu1a2:

Click to download the PDB-style file with coordinates for d2vu1a2.
(The format of our PDB-style files is described here.)

Timeline for d2vu1a2: