![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.25: Glycoside hydrolase family 61 [418803] (1 protein) Pfam PF03343 |
![]() | Protein Cellulase Cel61B [419106] (1 species) |
![]() | Species Hypocrea jecorina [TaxId:51453] [419620] (1 PDB entry) |
![]() | Domain d2vtca_: 2vtc A: [412974] complexed with ni |
PDB Entry: 2vtc (more details), 1.6 Å
SCOPe Domain Sequences for d2vtca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vtca_ b.1.18.25 (A:) Cellulase Cel61B {Hypocrea jecorina [TaxId: 51453]} hgqvqnftingqynqgfildyyyqkqntghfpnvagwyaedldlgfispdqyttpdivch knaapgaisataaagsnivfqwgpgvwphpygpivtyvvecsgscttvnknnlrwvkiqe aginyntqvwaqqdlinqgnkwtvkipsslrpgnyvfrhellaahgassangmqnypqcv niavtgsgtkalpagtpatqlykptdpgilfnpyttitsytipgpalw
Timeline for d2vtca_: