Lineage for d2vrda1 (2vrd A:1-61)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035498Family g.37.1.4: HkH motif-containing C2H2 finger [111436] (4 proteins)
    putative dsRNA-specific zinc finger with a helix-kink-helix (HkH) motif; the kink results from the incompatibility of the cation-coordinating H-x5-H motif with a regular alpha-helix and contributes to RNA recognition
  6. 3035503Protein Spliceosomal protein U1C [111437] (1 species)
  7. 3035504Species Human (Homo sapiens) [TaxId:9606] [111438] (2 PDB entries)
    Uniprot P09234 1-61
  8. 3035506Domain d2vrda1: 2vrd A:1-61 [153505]
    complexed with zn

Details for d2vrda1

PDB Entry: 2vrd (more details)

PDB Description: the structure of the zinc finger from the human spliceosomal protein u1c
PDB Compounds: (A:) u1 small nuclear ribonucleoprotein c

SCOPe Domain Sequences for d2vrda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]}
mpkfycdycdtylthdspsvrkthcsgrkhkenvkdyyqkwmeeqaqslidkttaafqqg
k

SCOPe Domain Coordinates for d2vrda1:

Click to download the PDB-style file with coordinates for d2vrda1.
(The format of our PDB-style files is described here.)

Timeline for d2vrda1: