Lineage for d2vmga1 (2vmg A:33-177)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530937Family b.18.1.33: NPCBM-like [158966] (3 proteins)
    Pfam PF08305
  6. 1530941Protein Uncharacterized Protein CPF2129 [158967] (1 species)
  7. 1530942Species Clostridium perfringens [TaxId:1502] [158968] (1 PDB entry)
    Uniprot Q0TP83 906-1050
  8. 1530943Domain d2vmga1: 2vmg A:33-177 [153326]
    complexed with ca, mbg

Details for d2vmga1

PDB Entry: 2vmg (more details), 1.9 Å

PDB Description: the structure of cbm51 from clostridium perfringens gh95 in complex with methyl-galactose
PDB Compounds: (A:) fibronectin type III domain protein

SCOPe Domain Sequences for d2vmga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vmga1 b.18.1.33 (A:33-177) Uncharacterized Protein CPF2129 {Clostridium perfringens [TaxId: 1502]}
tsvylselewksastgygeiqkdascdgntitlkgengekvsydkgigthahseivysle
gldyydyfetfvgvdqemagtvasisfevyldnekvfdsglmtgdttqkhvkvpiagknt
lklvvkdggdsigsdhgsfgdaklt

SCOPe Domain Coordinates for d2vmga1:

Click to download the PDB-style file with coordinates for d2vmga1.
(The format of our PDB-style files is described here.)

Timeline for d2vmga1: