Lineage for d2vm6a_ (2vm6 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626682Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2627094Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 2627095Protein automated matches [195066] (5 species)
    not a true protein
  7. 2627101Species Human (Homo sapiens) [TaxId:9606] [225196] (14 PDB entries)
  8. 2627113Domain d2vm6a_: 2vm6 A: [231342]
    automated match to d2voia_
    complexed with so4

Details for d2vm6a_

PDB Entry: 2vm6 (more details), 2.2 Å

PDB Description: human bcl2-a1 in complex with bim-bh3 peptide
PDB Compounds: (A:) bcl-2-related protein a1

SCOPe Domain Sequences for d2vm6a_:

Sequence, based on SEQRES records: (download)

>d2vm6a_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smtdcefgyiyrlaqdylqcvlqipqpgsgpsktsrvlqnvafsvqkeveknlkscldnv
nvvsvdtartlfnqvmekefedgiinwgrivtifafegilikkllrqqiapdvdtykeis
yfvaefimnntgewirqnggwengfvkkfe

Sequence, based on observed residues (ATOM records): (download)

>d2vm6a_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smtdcefgyiyrlaqdylqcvlqipsktsrvlqnvafsvqkeveknlkscldnvnvvsvd
tartlfnqvmekefedgiinwgrivtifafegilikkllrqqiapdvdtykeisyfvaef
imnntgewirqnggwengfvkkfe

SCOPe Domain Coordinates for d2vm6a_:

Click to download the PDB-style file with coordinates for d2vm6a_.
(The format of our PDB-style files is described here.)

Timeline for d2vm6a_: