Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.0: automated matches [195065] (1 protein) not a true family |
Protein automated matches [195066] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225196] (14 PDB entries) |
Domain d2vm6a_: 2vm6 A: [231342] automated match to d2voia_ complexed with so4 |
PDB Entry: 2vm6 (more details), 2.2 Å
SCOPe Domain Sequences for d2vm6a_:
Sequence, based on SEQRES records: (download)
>d2vm6a_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smtdcefgyiyrlaqdylqcvlqipqpgsgpsktsrvlqnvafsvqkeveknlkscldnv nvvsvdtartlfnqvmekefedgiinwgrivtifafegilikkllrqqiapdvdtykeis yfvaefimnntgewirqnggwengfvkkfe
>d2vm6a_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smtdcefgyiyrlaqdylqcvlqipsktsrvlqnvafsvqkeveknlkscldnvnvvsvd tartlfnqvmekefedgiinwgrivtifafegilikkllrqqiapdvdtykeisyfvaef imnntgewirqnggwengfvkkfe
Timeline for d2vm6a_: