| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) ![]() automatically mapped to Pfam PF01320 |
| Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins) |
| Protein automated matches [190365] (1 species) not a true protein |
| Species Escherichia coli [TaxId:562] [187200] (5 PDB entries) |
| Domain d2vloa_: 2vlo A: [153296] Other proteins in same PDB: d2vlob_ automated match to d1e0ha_ protein/DNA complex; complexed with so4; mutant |
PDB Entry: 2vlo (more details), 1.8 Å
SCOPe Domain Sequences for d2vloa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vloa_ a.28.2.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
khsisdyteaeflqlvtticnadtsseeelvklvthfeemtehpsgsdliyypkegddds
psgivntvkqwraangksgfkqglehhhhh
Timeline for d2vloa_: