Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (18 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [188424] (1 PDB entry) |
Domain d2vl6a_: 2vl6 A: [168676] automated match to d1ltle_ complexed with zn |
PDB Entry: 2vl6 (more details), 2.8 Å
SCOPe Domain Sequences for d2vl6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vl6a_ b.40.4.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} qidyrdvfieflttfkgnnnqnkyierinelvayrkksliiefsdvlsfnenlayeiinn tkiilpilegalydhilqldptyqrdiekvhvrivgiprvielrkirstdigklitidgi lvkvtpvkeriykatykhihpdcmqefewpedeempevlempticpkcgkpgqfrlipek tklidwqkaviqerpeevpsgqlprqleiileddlvdsarpgdrvkvtgildikqdspvk rgsravfdiymkvssievs
Timeline for d2vl6a_: