Class g: Small proteins [56992] (91 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
Protein automated matches [226968] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225423] (21 PDB entries) |
Domain d2vj3a3: 2vj3 A:492-530 [153182] automated match to d2vj3a3 complexed with ca, cl, na |
PDB Entry: 2vj3 (more details), 2.6 Å
SCOPe Domain Sequences for d2vj3a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vj3a3 g.3.11.0 (A:492-530) automated matches {Human (Homo sapiens) [TaxId: 9606]} decasspclhngrcldkinefqcecptgftghlcqvdlh
Timeline for d2vj3a3: