Lineage for d2viub_ (2viu B:)
- Root: SCOPe 2.05
Class h: Coiled coil proteins [57942] (7 folds) 
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
core: trimeric coiled coil
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) 
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) 
Protein Influenza hemagglutinin (stalk) [58066] (8 species)
trimerSpecies Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries) 
Domain d2viub_: 2viu B: [45676]
Other proteins in same PDB: d2viua_
complexed with nag
Details for d2viub_
PDB Entry: 2viu (more details), 2.5 Å
PDB Description: influenza virus hemagglutinin
PDB Compounds: (B:) HemagglutininSCOPe Domain Sequences for d2viub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2viub_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
SCOPe Domain Coordinates for d2viub_:
Click to download the PDB-style file with coordinates for d2viub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2viub_:
- d2viub_ first appeared (with stable ids) in SCOP 1.55
- d2viub_ appears in SCOPe 2.04
- d2viub_ appears in SCOPe 2.06
- d2viub_ appears in the current release, SCOPe 2.08
View in 3D
