Lineage for d2vidb_ (2vid B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.0: automated matches [191364] (1 protein)
not a true familyProtein automated matches [190438] (36 species)
not a true protein
Species Staphylococcus aureus [TaxId:1280] [187423] (6 PDB entries) 
Domain d2vidb_: 2vid B: [195319]
automated match to d2as9a_
Details for d2vidb_
PDB Entry: 2vid (more details), 1.8 Å
PDB Description: serine protease splb from staphylococcus aureus at 1.8a resolution
PDB Compounds: (B:) serine protease splbSCOPe Domain Sequences for d2vidb_:
Sequence, based on SEQRES records: (download)
>d2vidb_ b.47.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ennvtkvkdtnifpytgvvafksatgfvvgkntiltnkhvsknykvgdritahpnsdkgn
ggiysikkiinypgkedvsviqveeraiergpkgfnfndnvtpfkyaagakagerikvig
yphpyknkyvlyestgpvmsvegssivysahtesgnsgspvlnsnnelvgihfasdvknd
dnrnaygvyftpeikkfiaenidk
Sequence, based on observed residues (ATOM records): (download)
>d2vidb_ b.47.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ennvtkvkdtnifpytgvvafksatgfvvgkntiltnkhvsknykvgdritahpnsdkgn
ggiysikkiinypgkedvsviqveeraiergpkgfnfndnvtpfkyaagakagerikvig
yphpyknkyvlyestgpvmsvegssivysahtesgnsgspvlnsnnelvgihfasdvkrn
aygvyftpeikkfiaenidk
SCOPe Domain Coordinates for d2vidb_:
Click to download the PDB-style file with coordinates for d2vidb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2vidb_:
- d2vidb_ first appeared in SCOPe 2.02
- d2vidb_ appears in SCOPe 2.07
View in 3D
