Lineage for d2vgpb_ (2vgp B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPKFamily d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the commentsProtein automated matches [190091] (20 species)
not a true protein
Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (11 PDB entries) 
Domain d2vgpb_: 2vgp B: [168591]
automated match to d1ol5a_
complexed with ad6
Details for d2vgpb_
PDB Entry: 2vgp (more details), 1.7 Å
PDB Description: crystal structure of aurora b kinase in complex with a aminothiazole inhibitor
PDB Compounds: (B:) serine/threonine-protein kinase 12-aSCOPe Domain Sequences for d2vgpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vgpb_ d.144.1.7 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
talaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq
lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm
eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp
pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk
dliskllryhppqrlplkgvmehpwvkansrrvlppvy
SCOPe Domain Coordinates for d2vgpb_:
Click to download the PDB-style file with coordinates for d2vgpb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2vgpb_:
- d2vgpb_ first appeared in SCOPe 2.01
- d2vgpb_ appears in SCOPe 2.07
View in 3D
