Lineage for d2vgls_ (2vgl S:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970862Superfamily d.110.4: SNARE-like [64356] (5 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 2970875Family d.110.4.2: Clathrin coat assembly domain [75521] (3 proteins)
    automatically mapped to Pfam PF01217
  6. 2970879Protein Sigma2 adaptin (clathrin coat assembly protein AP17) [75524] (1 species)
  7. 2970880Species Mouse (Mus musculus) [TaxId:10090] [75525] (7 PDB entries)
  8. 2970882Domain d2vgls_: 2vgl S: [153036]
    Other proteins in same PDB: d2vgla_, d2vglb_, d2vglm1
    complexed with ihp

Details for d2vgls_

PDB Entry: 2vgl (more details), 2.6 Å

PDB Description: ap2 clathrin adaptor core
PDB Compounds: (S:) ap-2 complex subunit sigma-1

SCOPe Domain Sequences for d2vgls_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgls_ d.110.4.2 (S:) Sigma2 adaptin (clathrin coat assembly protein AP17) {Mouse (Mus musculus) [TaxId: 10090]}
mirfiliqnragktrlakwymqfdddekqklieevhavvtvrdakhtnfvefrnfkiiyr
ryaglyfcicvdvndnnlayleaihnfvevlneyfhnvceldlvfnfykvytvvdemfla
geiretsqtkvlkqllmlqsle

SCOPe Domain Coordinates for d2vgls_:

Click to download the PDB-style file with coordinates for d2vgls_.
(The format of our PDB-style files is described here.)

Timeline for d2vgls_: