Lineage for d2vgfa1 (2vgf A:160-261)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071820Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2071821Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 2071822Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 2071823Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 2071844Species Human (Homo sapiens) [TaxId:9606] [82151] (8 PDB entries)
  8. 2071859Domain d2vgfa1: 2vgf A:160-261 [168552]
    Other proteins in same PDB: d2vgfa2, d2vgfa3, d2vgfb2, d2vgfb3, d2vgfc2, d2vgfc3, d2vgfd2, d2vgfd3
    complexed with fbp, k, mn, pga; mutant

Details for d2vgfa1

PDB Entry: 2vgf (more details), 2.75 Å

PDB Description: human erythrocyte pyruvate kinase: t384m mutant
PDB Compounds: (A:) pyruvate kinase isozymes r/l

SCOPe Domain Sequences for d2vgfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgfa1 b.58.1.1 (A:160-261) Pyruvate kinase (PK) {Human (Homo sapiens) [TaxId: 9606]}
peirtgilqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyi
ddglislvvqkigpeglvtqvenggvlgsrkgvnlpgaqvdl

SCOPe Domain Coordinates for d2vgfa1:

Click to download the PDB-style file with coordinates for d2vgfa1.
(The format of our PDB-style files is described here.)

Timeline for d2vgfa1: