| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (140 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [187940] (7 PDB entries) |
| Domain d2vd2a_: 2vd2 A: [168463] automated match to d1z7me1 |
PDB Entry: 2vd2 (more details), 2.85 Å
SCOPe Domain Sequences for d2vd2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vd2a_ c.94.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
amgklltmampkgrifeeaagllrqagyrlpeefedsrkliidvpeenlrfilakpmdvt
tyvehgvadvgiagkdvmleeerdvyevldlniskchlavaglpntdwsgvapriatkyp
nvassyfreqgeqveiiklngsielapligladrivdivstgqtlkenglvetehicdit
srfivnpvsyrmkddvidemasrlslvveget
Timeline for d2vd2a_: