Lineage for d2v9ta_ (2v9t A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (26 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) 
Domain d2v9ta_: 2v9t A: [231317]
Other proteins in same PDB: d2v9tb_
automated match to d1ie5a_
Details for d2v9ta_
PDB Entry: 2v9t (more details), 1.7 Å
PDB Description: Complex between the second LRR domain of Slit2 and The first Ig domain from Robo1
PDB Compounds: (A:) roundabout homolog 1SCOPe Domain Sequences for d2v9ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v9ta_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slrqedfpprivehpsdlivskgepatlnckaegrptptiewykggervetdkddprshr
mllpsgslfflrivhgrksrpdegvyvcvarnylgeavshdasleva
SCOPe Domain Coordinates for d2v9ta_:
Click to download the PDB-style file with coordinates for d2v9ta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2v9ta_:
- d2v9ta_ first appeared in SCOPe 2.03
- d2v9ta_ appears in SCOPe 2.04
- d2v9ta_ appears in SCOPe 2.06
- d2v9ta_ appears in the current release, SCOPe 2.08
View in 3D
