Lineage for d2v90c_ (2v90 C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. Protein automated matches [190436] (9 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)
  8. Domain d2v90c_: 2v90 C: [168383]
    automated match to d1g9oa_
    complexed with so4

Details for d2v90c_

PDB Entry: 2v90 (more details), 2 Å

PDB Description: crystal structure of the 3rd pdz domain of intestine- and kidney- enriched pdz domain ikepp (pdzd3)
PDB Compounds: (C:) pdz domain-containing protein 3

SCOPe Domain Sequences for d2v90c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v90c_ b.36.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prclhlekgpqgfgfllreekgldgrpgqflwevdpglpakkagmqagdrlvavagesve
glgheetvsriqgqgscvsltvvdpeadretsv

SCOPe Domain Coordinates for d2v90c_ are not available.

Timeline for d2v90c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2v90a_, d2v90b_, d2v90d_, d2v90e_, d2v90f_