Lineage for d2v8qe2 (2v8q E:23-181)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.37: CBS-domain pair [54630] (1 superfamily)
duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/aSuperfamily d.37.1: CBS-domain pair [54631] (2 families) 
Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (15 PDB entries)
Uniprot P80385 182-326! Uniprot P80385 23-181
Domain d2v8qe2: 2v8q E:23-181 [152784]
Other proteins in same PDB: d2v8qa1, d2v8qb1
complexed with amp
Details for d2v8qe2
PDB Entry: 2v8q (more details), 2.1 Å
PDB Description: crystal structure of the regulatory fragment of mammalian ampk in complexes with amp
PDB Compounds: (E:) 5'-amp-activated protein kinase subunit gamma-1SCOPe Domain Sequences for d2v8qe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snssvyttfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfv
gmltitdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavs
slirnkihrlpvidpesgntlyilthkrilkflklfite
SCOPe Domain Coordinates for d2v8qe2:
Click to download the PDB-style file with coordinates for d2v8qe2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2v8qe2:
- d2v8qe2 first appeared in SCOP 1.75
- d2v8qe2 appears in SCOPe 2.06
- d2v8qe2 appears in the current release, SCOPe 2.08
View in 3D
