SCOPe 2.05: Domain d2v7pa1: 2v7p A:22-164

Lineage for d2v7pa1 (2v7p A:22-164)

Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)
Family c.2.1.0: automated matches [191313] (1 protein)
not a true family
Protein automated matches [190069] (203 species)
not a true protein
Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries)
Domain d2v7pa1: 2v7p A:22-164 [206261]
Other proteins in same PDB: d2v7pa2, d2v7pb2, d2v7pc2, d2v7pd2
automated match to d1llda1
complexed with nad, oxm

Details for d2v7pa1

PDB Entry: 2v7p (more details), 2.1 Å

PDB Description: crystal structure of lactate dehydrogenase from thermus thermophilus hb8 (holo form)

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2v7pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7pa1 c.2.1.0 (A:22-164) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsglppgrvvgsg

SCOPe Domain Coordinates for d2v7pa1:

Click to download the PDB-style file with coordinates for d2v7pa1.
(The format of our PDB-style files is described here.)

Timeline for d2v7pa1: