Lineage for d2v7ab_ (2v7a B:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the comments
Protein automated matches [190091] (17 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries) 
Domain d2v7ab_: 2v7a B: [194610]
automated match to d3ik3a_
complexed with 627, mg; mutant
Details for d2v7ab_
PDB Entry: 2v7a (more details), 2.5 Å
PDB Description: crystal structure of the t315i abl mutant in complex with the inhibitor pha-739358
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase ABL1SCOPe Domain Sequences for d2v7ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v7ab_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkei
khpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevnavvllymatqissamey
lekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslay
nkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmr
acwqwnpsdrpsfaeihqafetmfqessis
SCOPe Domain Coordinates for d2v7ab_:
Click to download the PDB-style file with coordinates for d2v7ab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2v7ab_:
- d2v7ab_ first appeared in SCOPe 2.02
- d2v7ab_ appears in SCOPe 2.05
- d2v7ab_ appears in SCOPe 2.07
- d2v7ab_ appears in the current release, SCOPe 2.08
View in 3D
