Lineage for d2v3qa1 (2v3q A:1-376)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162960Protein PstS-like phosphate-binding protein [159816] (1 species)
  7. 2162961Species Human (Homo sapiens) [TaxId:9606] [159817] (1 PDB entry)
    Uniprot P85173 1-376
  8. 2162962Domain d2v3qa1: 2v3q A:1-376 [152461]
    complexed with edo, gol, po4

Details for d2v3qa1

PDB Entry: 2v3q (more details), 1.89 Å

PDB Description: serendipitous discovery and x-ray structure of a human phosphate binding apolipoprotein
PDB Compounds: (A:) human phosphate binding protein

SCOPe Domain Sequences for d2v3qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v3qa1 c.94.1.1 (A:1-376) PstS-like phosphate-binding protein {Human (Homo sapiens) [TaxId: 9606]}
dingggatlpqklyltpdvltagfapyigvgsgkgkiaflenkynqfgtdttknvhwags
dskltatelatyaadkepgwgkliqvpsvatsvaipfrkaganavdlsvkelcgvfsgri
adwsgitgagrsgpiqvvyraessgttelftrflnakcttepgtfavtttfansyslglt
plagavaatgsdgvmaalndttvaegrityispdfaaptlaglddatkvarvgkgvvngv
avegkspaaanvsaaisvvplpaaadrgnpdvwvpvfgattgggvvaypdsgypilgftn
lifsqcyanatqtgqvrdfftkhygtsanndaaieanafvplpsnwkaavrasfltasna
lsigntnvcngkgrpq

SCOPe Domain Coordinates for d2v3qa1:

Click to download the PDB-style file with coordinates for d2v3qa1.
(The format of our PDB-style files is described here.)

Timeline for d2v3qa1: