Lineage for d2uz9a1 (2uz9 A:8-75,A:389-451)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turnsSuperfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) 
this domain is interrupted by the catalytic beta/alpha barrel domain
Family b.92.1.4: SAH/MTA deaminase-like [82224] (3 proteins) 
Protein Guanine deaminase [159336] (3 species) Species Human (Homo sapiens) [TaxId:9606] [159338] (2 PDB entries)
Uniprot Q9Y2T3 8-75,389-451
Domain d2uz9a1: 2uz9 A:8-75,A:389-451 [152323]
Other proteins in same PDB: d2uz9a2
complexed with xan, zn
Details for d2uz9a1
PDB Entry: 2uz9 (more details), 2.3 Å
PDB Description: human guanine deaminase (guad) in complex with zinc and its product xanthine.
PDB Compounds: (A:) guanine deaminaseSCOPe Domain Sequences for d2uz9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uz9a1 b.92.1.4 (A:8-75,A:389-451) Guanine deaminase {Human (Homo sapiens) [TaxId: 9606]}
plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire
lshheffmXfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrniee
vyvggkqvvpfs
SCOPe Domain Coordinates for d2uz9a1:
Click to download the PDB-style file with coordinates for d2uz9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2uz9a1:
- d2uz9a1 first appeared in SCOP 1.75
- d2uz9a1 appears in SCOPe 2.04
- d2uz9a1 appears in SCOPe 2.06
- d2uz9a1 appears in the current release, SCOPe 2.08
View in 3D
