Lineage for d2uyfa_ (2uyf A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879927Protein automated matches [190140] (18 species)
    not a true protein
  7. 1879936Species Burkholderia cepacia [TaxId:292] [255595] (2 PDB entries)
  8. 1879939Domain d2uyfa_: 2uyf A: [243828]
    automated match to d1utbb_
    protein/DNA complex; complexed with act, gol, scn; mutant

Details for d2uyfa_

PDB Entry: 2uyf (more details), 2.2 Å

PDB Description: single mutant f111l dntr from burkholderia sp. strain dnt in complex with thiocyanate
PDB Compounds: (A:) Regulatory protein

SCOPe Domain Sequences for d2uyfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uyfa_ c.94.1.1 (A:) automated matches {Burkholderia cepacia [TaxId: 292]}
sfdpfastrtfnlamtdigemylmpplmealaqraphiqistlrpnagnlkedmesgavd
lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfselehvgvvalntghge
vdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpakl
pdiainlfwhakynrdpgnmwlrqlfvelfseahh

SCOPe Domain Coordinates for d2uyfa_:

Click to download the PDB-style file with coordinates for d2uyfa_.
(The format of our PDB-style files is described here.)

Timeline for d2uyfa_: