Lineage for d2uy7b1 (2uy7 B:8-163)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. Protein Pap fimbrial major pilin protein PapA [158926] (1 species)
  7. Species Escherichia coli [TaxId:562] [158927] (2 PDB entries)
    Uniprot P04127 30-185! Uniprot P04127 32-185
  8. Domain d2uy7b1: 2uy7 B:8-163 [145764]
    Other proteins in same PDB: d2uy7a1, d2uy7a2, d2uy7c1, d2uy7c2, d2uy7d_, d2uy7e1, d2uy7e2, d2uy7f_, d2uy7g1, d2uy7g2, d2uy7h_
    complexed with so4

Details for d2uy7b1

PDB Entry: 2uy7 (more details), 2.6 Å

PDB Description: crystal structure of the p pilus rod subunit papa
PDB Compounds: (B:) pap fimbrial major pilin protein

SCOPe Domain Sequences for d2uy7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uy7b1 b.2.3.2 (B:8-163) Pap fimbrial major pilin protein PapA {Escherichia coli [TaxId: 562]}
qgkvtfnntvvdapcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafk
ggngakkgtvklaftgpivnghsdeldtnggtgtaivvqgagknvvfdgsegdantlkdg
envlhytavvkkssavgaavtegafsavanfnltyq

SCOPe Domain Coordinates for d2uy7b1 are not available.

Timeline for d2uy7b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2uy7a1, d2uy7a2, d2uy7c1, d2uy7c2, d2uy7d_, d2uy7e1, d2uy7e2, d2uy7f_, d2uy7g1, d2uy7g2, d2uy7h_