Lineage for d2uxqa_ (2uxq A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1182016Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1182017Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1182271Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 1182272Protein automated matches [190603] (14 species)
    not a true protein
  7. 1182306Species Desulfotalea psychrophila [TaxId:84980] [188344] (3 PDB entries)
  8. 1182307Domain d2uxqa_: 2uxq A: [168214]
    automated match to d1lwda_
    complexed with gol, mg, peg, so4

Details for d2uxqa_

PDB Entry: 2uxq (more details), 1.75 Å

PDB Description: isocitrate dehydrogenase from the psychrophilic bacterium desulfotalea psychrophila: biochemical properties and crystal structure analysis
PDB Compounds: (A:) isocitrate dehydrogenase native

SCOPe Domain Sequences for d2uxqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxqa_ c.77.1.0 (A:) automated matches {Desulfotalea psychrophila [TaxId: 84980]}
mkiqmktplveldgdemtrvlwplikdklllpfidlqteyydlgieerdrtndqitidaa
eaikkygvgvknatitpnqdrveeyglkeqwkspnatvramldgtvfrkpimvknikpsv
rswqkpivvgrhaygdfyknaeifaeaggkleivvtdkngketrqtimevdepaivqgih
ntvasighfaracfeysldqkidcwfatkdtiskqydqrfkiifeeifaqeykekfaaag
ieyfytliddvvarmmkteggmlwacknydgdvmsdmvasafgslammssvlvspygyfe
yeaahgtvqrhyyqhlkgertstnpvaliyawtgalrkrgeldgtpdlcafcdsleaiti
eciesgymtgdlaricepaaikvldsiefidelgkrlqqlnk

SCOPe Domain Coordinates for d2uxqa_:

Click to download the PDB-style file with coordinates for d2uxqa_.
(The format of our PDB-style files is described here.)

Timeline for d2uxqa_: