Lineage for d2uwha_ (2uwh A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. Protein Cytochrome P450 bm-3 [48268] (2 species)
  7. Species Bacillus megaterium [TaxId:1404] [48269] (95 PDB entries)
    Uniprot P14779
  8. Domain d2uwha_: 2uwh A: [168201]
    automated match to d1jpza_
    complexed with hem, plm; mutant

Details for d2uwha_

PDB Entry: 2uwh (more details), 2.8 Å

PDB Description: cytochrome p450 bm3 mutant in complex with palmitic acid
PDB Compounds: (A:) bifunctional p-450: nadph-p450 reductase

SCOPe Domain Sequences for d2uwha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uwha_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdffgdglftswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
fdfedhtnyeldiketltlkpegfvvkakskkiplggi

SCOPe Domain Coordinates for d2uwha_ are not available.

Timeline for d2uwha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2uwhb_, d2uwhc_, d2uwhd_, d2uwhe_, d2uwhf_