| Class b: All beta proteins [48724] (180 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) ![]() |
| Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
| Protein automated matches [190637] (2 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [188437] (2 PDB entries) |
| Domain d2uusa_: 2uus A: [168177] automated match to d1djsb_ |
PDB Entry: 2uus (more details), 2.2 Å
SCOPe Domain Sequences for d2uusa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uusa_ b.42.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesagevyikgtetgqyla
mdtegllygsqtpneeclflerleenhyntytskkhaeknwfvglkkngsckrgprthyg
qkailflplpvs
Timeline for d2uusa_: