Lineage for d2uusa_ (2uus A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2791606Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2791607Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2791906Protein automated matches [190637] (2 species)
    not a true protein
  7. 2791919Species Norway rat (Rattus norvegicus) [TaxId:10116] [188437] (2 PDB entries)
  8. 2791922Domain d2uusa_: 2uus A: [168177]
    automated match to d1djsb_

Details for d2uusa_

PDB Entry: 2uus (more details), 2.2 Å

PDB Description: crystal structure of the rat fgf1-sucrose octasulfate (sos) complex.
PDB Compounds: (A:) heparin-binding growth factor 1

SCOPe Domain Sequences for d2uusa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uusa_ b.42.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesagevyikgtetgqyla
mdtegllygsqtpneeclflerleenhyntytskkhaeknwfvglkkngsckrgprthyg
qkailflplpvs

SCOPe Domain Coordinates for d2uusa_:

Click to download the PDB-style file with coordinates for d2uusa_.
(The format of our PDB-style files is described here.)

Timeline for d2uusa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2uusb_