Lineage for d2tysb_ (2tys B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156898Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2156899Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2156900Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2157086Protein Tryptophan synthase, beta-subunit [53688] (4 species)
  7. 2157109Species Salmonella typhimurium [TaxId:90371] [53689] (44 PDB entries)
  8. 2157125Domain d2tysb_: 2tys B: [35272]
    Other proteins in same PDB: d2tysa_
    complexed with na, plt; mutant

Details for d2tysb_

PDB Entry: 2tys (more details), 1.9 Å

PDB Description: crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes
PDB Compounds: (B:) tryptophan synthase

SCOPe Domain Sequences for d2tysb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tysb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahttnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdilkargei

SCOPe Domain Coordinates for d2tysb_:

Click to download the PDB-style file with coordinates for d2tysb_.
(The format of our PDB-style files is described here.)

Timeline for d2tysb_: