Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.5: TMV-like viral coat proteins [47195] (1 family) automatically mapped to Pfam PF00721 |
Family a.24.5.1: TMV-like viral coat proteins [47196] (4 proteins) |
Protein Tobacco mosaic virus coat protein [47197] (1 species) |
Species Tobacco mosaic virus, vulgare strain [TaxId:12242] [47198] (5 PDB entries) |
Domain d2tmvp_: 2tmv P: [16586] protein/RNA complex; complexed with ca |
PDB Entry: 2tmv (more details), 2.9 Å
SCOPe Domain Sequences for d2tmvp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tmvp_ a.24.5.1 (P:) Tobacco mosaic virus coat protein {Tobacco mosaic virus, vulgare strain [TaxId: 12242]} sysittpsqfvflssawadpielinlctnalgnqfqtqqartvvqrqfsevwkpspqvtv rfpdsdfkvyrynavldplvtallgafdtrnriievenqanpttaetldatrrvddatva irsainnlivelirgtgsynrssfesssglvwts
Timeline for d2tmvp_: