![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.84: Subtilisin inhibitor [55398] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) ![]() |
![]() | Family d.84.1.1: Subtilisin inhibitor [55400] (1 protein) automatically mapped to Pfam PF00720 |
![]() | Protein Subtilisin inhibitor [55401] (2 species) |
![]() | Species Streptomyces lividans [TaxId:1916] [55402] (3 PDB entries) |
![]() | Domain d2tldi_: 2tld I: [40030] Other proteins in same PDB: d2tlde_ CA-atoms only |
PDB Entry: 2tld (more details), 2.6 Å
SCOPe Domain Sequences for d2tldi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tldi_ d.84.1.1 (I:) Subtilisin inhibitor {Streptomyces lividans [TaxId: 1916]} salyapsalvltvgkgvsattaaperavtltcapgpsgthpaagsacadlaavggdlnal trgedvgcpkvydpvlltvdgvwqgkrvsyervfsnecemnahgssvfaf
Timeline for d2tldi_: