Lineage for d2tcta1 (2tct A:2-67)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (20 families) 
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) 
Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species) Species Escherichia coli [TaxId:562] [46766] (22 PDB entries) 
Domain d2tcta1: 2tct A:2-67 [16063]
Other proteins in same PDB: d2tcta2
complexed with ctc, mg
Details for d2tcta1
PDB Entry: 2tct (more details), 2.1 Å
PDB Description: the complex formed between tet repressor and tetracycline-mg2+ reveals mechanism of antibiotic resistance
PDB Compounds: (A:) tetracycline repressorSCOPe Domain Sequences for d2tcta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tcta1 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
arlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys
SCOPe Domain Coordinates for d2tcta1:
Click to download the PDB-style file with coordinates for d2tcta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tcta1:
- d2tcta1 first appeared (with stable ids) in SCOP 1.55, called d2tct_1
- d2tcta1 appears in SCOPe 2.04
- d2tcta1 appears in SCOPe 2.06
- d2tcta1 appears in the current release, SCOPe 2.08
View in 3D
