Lineage for d2tcla_ (2tcl A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964341Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 2964342Species Human (Homo sapiens) [TaxId:9606] [55530] (13 PDB entries)
    Uniprot P03956 32-466
  8. 2964345Domain d2tcla_: 2tcl A: [40337]
    complexed with ca, ro4, sm, zn

Details for d2tcla_

PDB Entry: 2tcl (more details), 2.2 Å

PDB Description: structure of the catalytic domain of human fibroblast collagenase complexed with an inhibitor
PDB Compounds: (A:) fibroblast collagenase

SCOPe Domain Sequences for d2tcla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tcla_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
ltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimi
sfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelg
hslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsq

SCOPe Domain Coordinates for d2tcla_:

Click to download the PDB-style file with coordinates for d2tcla_.
(The format of our PDB-style files is described here.)

Timeline for d2tcla_: