![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.84: Subtilisin inhibitor [55398] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) ![]() |
![]() | Family d.84.1.1: Subtilisin inhibitor [55400] (1 protein) automatically mapped to Pfam PF00720 |
![]() | Protein Subtilisin inhibitor [55401] (2 species) |
![]() | Species Streptomyces albogriseolus, s-3253 [TaxId:1887] [55403] (2 PDB entries) |
![]() | Domain d2sici_: 2sic I: [40031] Other proteins in same PDB: d2sice_ complexed with ca |
PDB Entry: 2sic (more details), 1.8 Å
SCOPe Domain Sequences for d2sici_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sici_ d.84.1.1 (I:) Subtilisin inhibitor {Streptomyces albogriseolus, s-3253 [TaxId: 1887]} yapsalvltvgkgvsattaaperavtltcapgpsgthpaagsacadlaavggdlnaltrg edvmcpmvydpvlltvdgvwqgkrvsyervfsnecemnahgssvfaf
Timeline for d2sici_: