Lineage for d2sici_ (2sic I:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1916488Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
    alpha+beta sandwich
  4. 1916489Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) (S)
  5. 1916490Family d.84.1.1: Subtilisin inhibitor [55400] (1 protein)
    automatically mapped to Pfam PF00720
  6. 1916491Protein Subtilisin inhibitor [55401] (2 species)
  7. 1916492Species Streptomyces albogriseolus, s-3253 [TaxId:1887] [55403] (2 PDB entries)
  8. 1916493Domain d2sici_: 2sic I: [40031]
    Other proteins in same PDB: d2sice_
    complexed with ca

Details for d2sici_

PDB Entry: 2sic (more details), 1.8 Å

PDB Description: refined crystal structure of the complex of subtilisin bpn' and streptomyces subtilisin inhibitor at 1.8 angstroms resolution
PDB Compounds: (I:) streptomyces subtilisin inhibitor (ssi)

SCOPe Domain Sequences for d2sici_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sici_ d.84.1.1 (I:) Subtilisin inhibitor {Streptomyces albogriseolus, s-3253 [TaxId: 1887]}
yapsalvltvgkgvsattaaperavtltcapgpsgthpaagsacadlaavggdlnaltrg
edvmcpmvydpvlltvdgvwqgkrvsyervfsnecemnahgssvfaf

SCOPe Domain Coordinates for d2sici_:

Click to download the PDB-style file with coordinates for d2sici_.
(The format of our PDB-style files is described here.)

Timeline for d2sici_: