Lineage for d2sici_ (2sic I:)
- Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
alpha+beta sandwichSuperfamily d.84.1: Subtilisin inhibitor [55399] (2 families) 
Family d.84.1.1: Subtilisin inhibitor [55400] (1 protein) Protein Subtilisin inhibitor [55401] (2 species) Species Streptomyces albogriseolus, s-3253 [TaxId:1887] [55403] (2 PDB entries) 
Domain d2sici_: 2sic I: [40031]
Other proteins in same PDB: d2sice_
complexed with ca
Details for d2sici_
PDB Entry: 2sic (more details), 1.8 Å
PDB Description: refined crystal structure of the complex of subtilisin bpn' and streptomyces subtilisin inhibitor at 1.8 angstroms resolution
PDB Compounds: (I:) streptomyces subtilisin inhibitor (ssi)SCOPe Domain Sequences for d2sici_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sici_ d.84.1.1 (I:) Subtilisin inhibitor {Streptomyces albogriseolus, s-3253 [TaxId: 1887]}
yapsalvltvgkgvsattaaperavtltcapgpsgthpaagsacadlaavggdlnaltrg
edvmcpmvydpvlltvdgvwqgkrvsyervfsnecemnahgssvfaf
SCOPe Domain Coordinates for d2sici_:
Click to download the PDB-style file with coordinates for d2sici_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2sici_:
- d2sici_ first appeared (with stable ids) in SCOP 1.55
- d2sici_ appears in SCOPe 2.01
- d2sici_ appears in SCOPe 2.03
- d2sici_ appears in the current release, SCOPe 2.08
View in 3D
