Lineage for d2semb_ (2sem B:)
- Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helixSuperfamily b.34.2: SH3-domain [50044] (2 families) 
Family b.34.2.1: SH3-domain [50045] (40 proteins) 
Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species) 
Species Caenorhabditis elegans, SEM-5 [TaxId:6239] [50073] (5 PDB entries)
Sex muscle abnormal protein 5
Domain d2semb_: 2sem B: [24547]
C-terminal domain
Details for d2semb_
PDB Entry: 2sem (more details), 2.2 Å
PDB Description: sem5 sh3 domain complexed with peptoid inhibitor
PDB Compounds: (B:) protein (sex muscle abnormal protein 5)SCOPe Domain Sequences for d2semb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2semb_ b.34.2.1 (B:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]}
tkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpynsn
SCOPe Domain Coordinates for d2semb_:
Click to download the PDB-style file with coordinates for d2semb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2semb_:
- d2semb_ first appeared (with stable ids) in SCOP 1.55
- d2semb_ appears in SCOP 1.75
- d2semb_ appears in SCOPe 2.02
- d2semb_ appears in the current release, SCOPe 2.08
View in 3D
