| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species) |
| Species Caenorhabditis elegans, SEM-5 [TaxId:6239] [50073] (5 PDB entries) Sex muscle abnormal protein 5 |
| Domain d2semb_: 2sem B: [24547] C-terminal domain |
PDB Entry: 2sem (more details), 2.2 Å
SCOPe Domain Sequences for d2semb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2semb_ b.34.2.1 (B:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]}
tkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpynsn
Timeline for d2semb_: