Lineage for d2rnrb1 (2rnr B:1-108)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1323359Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1323360Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1323861Family b.55.1.9: TFIIH domain [110272] (2 proteins)
  6. 1323867Protein TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain [110273] (1 species)
  7. 1323868Species Human (Homo sapiens) [TaxId:9606] [110274] (2 PDB entries)
    Uniprot P32780 1-108
  8. 1323869Domain d2rnrb1: 2rnr B:1-108 [152172]
    automatically matched to d1pfja_
    protein/DNA complex

Details for d2rnrb1

PDB Entry: 2rnr (more details)

PDB Description: solution structure of the complex between tfiie alpha c-terminal acidic domain and tfiih p62 ph domain
PDB Compounds: (B:) TFIIH basal transcription factor complex p62 subunit

SCOPe Domain Sequences for d2rnrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rnrb1 b.55.1.9 (B:1-108) TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan

SCOPe Domain Coordinates for d2rnrb1:

Click to download the PDB-style file with coordinates for d2rnrb1.
(The format of our PDB-style files is described here.)

Timeline for d2rnrb1: