Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.9: TFIIH domain [110272] (2 proteins) |
Protein TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain [110273] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [110274] (2 PDB entries) Uniprot P32780 1-108 |
Domain d2rnrb1: 2rnr B:1-108 [152172] automatically matched to d1pfja_ protein/DNA complex |
PDB Entry: 2rnr (more details)
SCOPe Domain Sequences for d2rnrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rnrb1 b.55.1.9 (B:1-108) TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan
Timeline for d2rnrb1: