Lineage for d2rnfa_ (2rnf A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.5: RNase A-like [54075] (1 superfamily)
contains long curved beta-sheet and 3 helicesSuperfamily d.5.1: RNase A-like [54076] (2 families) 
can be classified as disulfide-richFamily d.5.1.1: Ribonuclease A-like [54077] (9 proteins) 
Protein Ribonuclease 4 [54092] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54093] (2 PDB entries) 
Domain d2rnfa_: 2rnf A: [37293]
complexed with um3
Details for d2rnfa_
PDB Entry: 2rnf (more details), 2.4 Å
PDB Description: x-ray crystal structure of human ribonuclease 4 in complex with d(up)
PDB Compounds: (A:) ribonuclease 4SCOPe Domain Sequences for d2rnfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rnfa_ d.5.1.1 (A:) Ribonuclease 4 {Human (Homo sapiens) [TaxId: 9606]}
mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg
SCOPe Domain Coordinates for d2rnfa_:
Click to download the PDB-style file with coordinates for d2rnfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2rnfa_:
View in 3D
