Lineage for d2rnfa_ (2rnf A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928139Protein Ribonuclease 4 [54092] (1 species)
  7. 2928140Species Human (Homo sapiens) [TaxId:9606] [54093] (2 PDB entries)
  8. 2928143Domain d2rnfa_: 2rnf A: [37293]
    complexed with um3

Details for d2rnfa_

PDB Entry: 2rnf (more details), 2.4 Å

PDB Description: x-ray crystal structure of human ribonuclease 4 in complex with d(up)
PDB Compounds: (A:) ribonuclease 4

SCOPe Domain Sequences for d2rnfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rnfa_ d.5.1.1 (A:) Ribonuclease 4 {Human (Homo sapiens) [TaxId: 9606]}
mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg

SCOPe Domain Coordinates for d2rnfa_:

Click to download the PDB-style file with coordinates for d2rnfa_.
(The format of our PDB-style files is described here.)

Timeline for d2rnfa_: