Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) |
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
Protein automated matches [190420] (8 species) not a true protein |
Species European mistletoe (Viscum album) [TaxId:3972] [188629] (6 PDB entries) |
Domain d2rg9a_: 2rg9 A: [161550] Other proteins in same PDB: d2rg9b1, d2rg9b2 automated match to d1puua_ complexed with azi, cl, gol, nag, so4 |
PDB Entry: 2rg9 (more details), 1.95 Å
SCOPe Domain Sequences for d2rg9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rg9a_ d.165.1.1 (A:) automated matches {European mistletoe (Viscum album) [TaxId: 3972]} yerlslrtvqqttgeeyfsfitllrdfvssgsfsnnipllrqstipvseasrfvlveltn eggdsitaaidvtnlyvvayqagqqsyflkdaprgaetqdftgttrsslpfngsypdler yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlalppgnvvtltnirdviasl aimlfvcge
Timeline for d2rg9a_: