![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.6: oligoketide cyclase/dehydrase-like [118101] (4 proteins) Pfam PF03654 |
![]() | Protein Multifunctional enzyme TcmN, cyclase/aromatase domain [160740] (1 species) |
![]() | Species Streptomyces glaucescens [TaxId:1907] [160741] (4 PDB entries) Uniprot P16559 1-152! Uniprot P16559 1-155 |
![]() | Domain d2reza_: 2rez A: [151992] automated match to d2rera1 complexed with act, iod |
PDB Entry: 2rez (more details), 1.95 Å
SCOPe Domain Sequences for d2reza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2reza_ d.129.3.6 (A:) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} gshmaartdnsivvnapfelvwdvtndieawpelfseyaeaeilrqdgdgfdfrlktrpd angrvwewvshrvpdkgsrtvrahrvetgpfaymnlhwtyravaggtemrwvqefdmkpg apfdnahmtahlntttranmerikkiiedrhregq
Timeline for d2reza_: