Lineage for d2rera1 (2rer A:1-155)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926373Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1926628Family d.129.3.6: oligoketide cyclase/dehydrase-like [118101] (4 proteins)
    Pfam PF03654
  6. 1926635Protein Multifunctional enzyme TcmN, cyclase/aromatase domain [160740] (1 species)
  7. 1926636Species Streptomyces glaucescens [TaxId:1907] [160741] (4 PDB entries)
    Uniprot P16559 1-152! Uniprot P16559 1-155
  8. 1926638Domain d2rera1: 2rer A:1-155 [151981]

Details for d2rera1

PDB Entry: 2rer (more details), 1.9 Å

PDB Description: Crystal structure of the aromatase/cyclase domain of TcmN from Streptomyces glaucescens
PDB Compounds: (A:) Multifunctional cyclase-dehydratase-3-O-methyl transferase tcmN

SCOPe Domain Sequences for d2rera1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]}
maartdnsivvnapfelvwdvtndieawpelfseyaeaeilrqdgdgfdfrlktrpdang
rvwewvshrvpdkgsrtvrahrvetgpfaymnlhwtyravaggtemrwvqefdmkpgapf
dnahmtahlntttranmerikkiiedrhregqrtp

SCOPe Domain Coordinates for d2rera1:

Click to download the PDB-style file with coordinates for d2rera1.
(The format of our PDB-style files is described here.)

Timeline for d2rera1: