Lineage for d2remc_ (2rem C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370861Species Xylella fastidiosa [TaxId:2371] [196083] (2 PDB entries)
  8. 1370865Domain d2remc_: 2rem C: [196084]
    automated match to d3h93a_

Details for d2remc_

PDB Entry: 2rem (more details), 1.9 Å

PDB Description: crystal structure of oxidoreductase dsba from xylella fastidiosa
PDB Compounds: (C:) Disulfide oxidoreductase

SCOPe Domain Sequences for d2remc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2remc_ c.47.1.0 (C:) automated matches {Xylella fastidiosa [TaxId: 2371]}
nhlpvvgedyveipdgrpfaplagkievveifgytcphcahfdsklqawgarqakdvrft
lvpavfggvwdpfaraylaadvlgvakrshtamfeaihekgsvpiqnvgpdelavfyagy
gvqpdrfvatfngpevekrfqaarayalkvrpvgtptivvngrymvtghdfedtlritdy
lvsreraashg

SCOPe Domain Coordinates for d2remc_:

Click to download the PDB-style file with coordinates for d2remc_.
(The format of our PDB-style files is described here.)

Timeline for d2remc_: