Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
Protein automated matches [226834] (5 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [225054] (9 PDB entries) |
Domain d2rdga1: 2rdg A:5-93 [231254] Other proteins in same PDB: d2rdga2 automated match to d3o13a1 complexed with cit, k |
PDB Entry: 2rdg (more details), 1.6 Å
SCOPe Domain Sequences for d2rdga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rdga1 b.40.2.0 (A:5-93) automated matches {Staphylococcus aureus [TaxId: 1280]} vrsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdgnnen ldvfvvregsgrqadnnsiggitktnrtq
Timeline for d2rdga1: