Lineage for d2rd2a1 (2rd2 A:339-547)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
barrel, closed; n=6, S=10; complex topologySuperfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) 
Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein)
automatically mapped to Pfam PF03950Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (2 species)
duplication, consists of two barrel domains with the swapping of N-terminal strands
Species Escherichia coli K-12 [TaxId:83333] [159201] (1 PDB entry) 
Domain d2rd2a1: 2rd2 A:339-547 [151918]
Other proteins in same PDB: d2rd2a2
automatically matched to d1euqa1
protein/RNA complex; complexed with qsi, so4; mutant
Details for d2rd2a1
PDB Entry: 2rd2 (more details), 2.6 Å
PDB Description: glutaminyl-trna synthetase mutant c229r with bound analog 5'-o-[n-(l- glutaminyl)-sulfamoyl]adenosine
PDB Compounds: (A:) glutaminyl-tRNA synthetaseSCOPe Domain Sequences for d2rd2a1:
Sequence, based on SEQRES records: (download)
>d2rd2a1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli K-12 [TaxId: 83333]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw
vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf
eregyfcldsrhstaekpvfnrtvglrdt
Sequence, based on observed residues (ATOM records): (download)
>d2rd2a1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli K-12 [TaxId: 83333]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlgvihwvsaahalpvei
rlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsr
hstaekpvfnrtvglrdt
SCOPe Domain Coordinates for d2rd2a1:
Click to download the PDB-style file with coordinates for d2rd2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2rd2a1:
- d2rd2a1 first appeared in SCOP 1.75
- d2rd2a1 appears in SCOPe 2.04
- d2rd2a1 appears in SCOPe 2.06
- d2rd2a1 appears in the current release, SCOPe 2.08
View in 3D
