Class b: All beta proteins [48724] (176 folds) |
Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) |
Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein) automatically mapped to Pfam PF03950 |
Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (2 species) duplication, consists of two barrel domains with the swapping of N-terminal strands |
Species Escherichia coli K-12 [TaxId:83333] [159201] (1 PDB entry) |
Domain d2rd2a1: 2rd2 A:339-547 [151918] Other proteins in same PDB: d2rd2a2 automatically matched to d1euqa1 protein/RNA complex; complexed with qsi, so4; mutant |
PDB Entry: 2rd2 (more details), 2.6 Å
SCOPe Domain Sequences for d2rd2a1:
Sequence, based on SEQRES records: (download)
>d2rd2a1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli K-12 [TaxId: 83333]} apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf eregyfcldsrhstaekpvfnrtvglrdt
>d2rd2a1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli K-12 [TaxId: 83333]} apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlgvihwvsaahalpvei rlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsr hstaekpvfnrtvglrdt
Timeline for d2rd2a1: