![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.15: EutN/CcmL-like [159133] (2 families) ![]() homohexameric unit |
![]() | Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins) Pfam PF03319 |
![]() | Protein Carboxysome shell protein [159137] (1 species) Unidentified carboxysome polypeptide |
![]() | Species Thiobacillus neapolitanus [TaxId:927] [159138] (1 PDB entry) Uniprot O85043 1-82 |
![]() | Domain d2rcfd_: 2rcf D: [151888] automated match to d2rcfa1 complexed with cl, gol |
PDB Entry: 2rcf (more details), 2.15 Å
SCOPe Domain Sequences for d2rcfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rcfd_ b.40.15.1 (D:) Carboxysome shell protein {Thiobacillus neapolitanus [TaxId: 927]} mkimqvektlvstnriadmghkpllvvwekpgaprqvavdaigcipgdwvlcvgssaare aagsksypsdltiigiidqw
Timeline for d2rcfd_:
![]() Domains from other chains: (mouse over for more information) d2rcfa1, d2rcfb_, d2rcfc_, d2rcfe_ |