Lineage for d2raqa1 (2raq A:3-95)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2956338Superfamily d.58.61: MTH889-like [160363] (2 families) (S)
    assembles into hexameric ring-like structures with the formation of a singe beta-barrel sheet of 24 strands
  5. 2956339Family d.58.61.1: MTH889-like [160364] (2 proteins)
    Pfam PF02680; DUF211, COG1888
  6. 2956356Protein Uncharacterized protein MTH889 [160365] (1 species)
  7. 2956357Species Methanobacterium thermoautotrophicum [TaxId:145262] [160366] (1 PDB entry)
    Uniprot O26975 3-95
  8. 2956358Domain d2raqa1: 2raq A:3-95 [151827]
    complexed with ca

Details for d2raqa1

PDB Entry: 2raq (more details), 3.11 Å

PDB Description: crystal structure of the mth889 protein from methanothermobacter thermautotrophicus. northeast structural genomics consortium target tt205
PDB Compounds: (A:) Conserved protein MTH889

SCOPe Domain Sequences for d2raqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
akglirivldilkphepiipeyakylselrgvegvnitlmeidketenikvtiqgndldf
deitraiesyggsihsvdevvagrtmveevttp

SCOPe Domain Coordinates for d2raqa1:

Click to download the PDB-style file with coordinates for d2raqa1.
(The format of our PDB-style files is described here.)

Timeline for d2raqa1: