Lineage for d2r9va3 (2r9v A:373-503)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717688Species Thermotoga maritima [TaxId:243274] [255580] (1 PDB entry)
  8. 2717689Domain d2r9va3: 2r9v A:373-503 [243669]
    Other proteins in same PDB: d2r9va1, d2r9va2
    automated match to d1skyb1
    complexed with atp, cl, mg, pg4

Details for d2r9va3

PDB Entry: 2r9v (more details), 2.1 Å

PDB Description: crystal structure of atp synthase subunit alpha (tm1612) from thermotoga maritima at 2.10 a resolution
PDB Compounds: (A:) ATP synthase subunit alpha

SCOPe Domain Sequences for d2r9va3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r9va3 a.69.1.0 (A:373-503) automated matches {Thermotoga maritima [TaxId: 243274]}
ikamkqvagmlridlaqyreletfaqfateldpatraqiirgqrlmellkqeqyspmpve
eqvvvlfagvrgylddlpveevrrfekeflrfmhekhqdilddiktkkeltseteeklkk
aieefkttfrv

SCOPe Domain Coordinates for d2r9va3:

Click to download the PDB-style file with coordinates for d2r9va3.
(The format of our PDB-style files is described here.)

Timeline for d2r9va3: