![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
![]() | Protein automated matches [227126] (21 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255577] (2 PDB entries) |
![]() | Domain d2r8pb1: 2r8p B:333-527 [151740] Other proteins in same PDB: d2r8pa2, d2r8pa3, d2r8pb2, d2r8pb3, d2r8pb4 automated match to d2r8pb1 complexed with ca, edo, t6f |
PDB Entry: 2r8p (more details), 1.65 Å
SCOPe Domain Sequences for d2r8pb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r8pb1 c.36.1.0 (B:333-527) automated matches {Escherichia coli K-12 [TaxId: 83333]} mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapsnltlwsg skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk qrqvmvythdsiglgedgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg ptalilsrqnlaqqe
Timeline for d2r8pb1: