Lineage for d2r8oa3 (2r8o A:528-663)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880614Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2880615Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2880616Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 2880635Protein Transketolase (TK), C-domain [52924] (4 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. 2880651Species Escherichia coli [TaxId:562] [89712] (4 PDB entries)
  8. 2880654Domain d2r8oa3: 2r8o A:528-663 [151733]
    Other proteins in same PDB: d2r8oa1, d2r8oa2, d2r8ob1, d2r8ob2, d2r8ob4
    automated match to d2r8oa3
    complexed with ca, edo, t5x

Details for d2r8oa3

PDB Entry: 2r8o (more details), 1.47 Å

PDB Description: transketolase from e. coli in complex with substrate d-xylulose-5- phosphate
PDB Compounds: (A:) Transketolase 1

SCOPe Domain Sequences for d2r8oa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8oa3 c.48.1.1 (A:528-663) Transketolase (TK), C-domain {Escherichia coli [TaxId: 562]}
rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd
afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee
fgftvdnvvakakell

SCOPe Domain Coordinates for d2r8oa3:

Click to download the PDB-style file with coordinates for d2r8oa3.
(The format of our PDB-style files is described here.)

Timeline for d2r8oa3: